PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_2.345
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 610aa    MW: 66639.9 Da    PI: 7.6159
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_2.345genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.92e-33260317260
                                  --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                         WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                  dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  evm.model.supercontig_2.345 260 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGTHNHPK 317
                                  8****************************************.***************85 PP

2WRKY105.92.1e-33437495159
                                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  evm.model.supercontig_2.345 437 LDDGYRWRKYGQKVVKGNPNPRSYYKCTYPGCPVRKHVERASHDLRAVITTYEGKHNHD 495
                                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.809.2E-28252318IPR003657WRKY domain
PROSITE profilePS5081123.835254318IPR003657WRKY domain
SuperFamilySSF1182901.57E-25255318IPR003657WRKY domain
SMARTSM007741.4E-36259317IPR003657WRKY domain
PfamPF031069.6E-26260316IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.0E-37422497IPR003657WRKY domain
SuperFamilySSF1182901.44E-29429497IPR003657WRKY domain
PROSITE profilePS5081138.033432497IPR003657WRKY domain
SMARTSM007742.3E-39437496IPR003657WRKY domain
PfamPF031067.8E-26438495IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 610 aa     Download sequence    Send to blast
MASSYGGRLD TSTNLHQITT AGSSFTFPTH SFMNTSFTGL LNSSSLDDDE QLKVAAVNSA  60
DETTRRGGLS LSDRIAERTG SGVPKFKSIS PPSLPLSPPP FSPSSYFAIP PGLSPAELLD  120
SPVLLSSSNI LPSPTTGTFP AQAFNWKGNN PQEIKQENTN NYSDFSFQPR PRPPTSSTGF  180
QSSATTTTIT TATQQSWSFQ ESSKQDMVKP DYSSMQSFSP EISTIQTTTQ STNKTSGFQS  240
DCGNYHQQQP QGHRESRRSD DGYNWRKYGQ KQVKGSENPR SYYKCTYPNC PTKKKVERSL  300
DGQITEIVYK GTHNHPKPQS TRRSSSSSSS SSIASSHVIQ GSNQLSGEIP DQSFVTNGIG  360
QMDSAATPDN SSISIGDDDF DRSSQKSKSG GDDLDEDEPG AKRWKIEGEN EGISAPGSRT  420
VREPRVVVQT TSDIDILDDG YRWRKYGQKV VKGNPNPRSY YKCTYPGCPV RKHVERASHD  480
LRAVITTYEG KHNHDVPPAR GSGSHSINRP PFPDNNNNSN SNNAAMTIRP IANVTDNSIT  540
YPLRNLRQQS SEGQSPLSLD MLQSPGSFGF PGFGNPLGSY IPQAPNTNNM FPRAKEEPRD  600
DLFLESLLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-36260497877Probable WRKY transcription factor 4
1wj2_A1e-36260497877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007017012.10.0WRKY DNA-binding protein 33 isoform 1
TrEMBLA0A061GYP00.0A0A061GYP0_THECC; WRKY DNA-binding protein 33 isoform 1
STRINGGLYMA14G38010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45832755
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-107WRKY DNA-binding protein 33